Product Categories
| Country: | United States |
|---|---|
| Tel: | 16314854226 |
| Mobile: | +16314854226 |
| E-mail: | |
| QQ: | |
| Skype: | Chat Now! |
| Product Name | MF | CAS | Details |
|---|
| Receptor tyrosine-protein kinase erbB-2 precursor (369-386) | Details |
| Receptor tyrosine-protein kinase erbB-2 (689-697) | Details |
| Retinal dehydrogenase 1 (88-96) | Details |
| Ribosomal protein S26 (47-61) | Details |
| RER1 protein (80-91) | Details |
| Rhodopsin Epitope Tag | C??H??N??O?? | Details |
| TAG-1 A2 (78-86) | Details |
| Telomerase reverse transcriptase (461-469) | Details |
| Survivin (80-88) | Details |
| Telomerare Reverse Transcriptase (hTRT) (653-661) | Details |
| Telomerase reverse transcriptase (672-686) | Details |
| SYSMEHFRWGKPS | C??H???N??O??S | Details |
| Telomerase reverse transcriptase (540-548) | Details |
| Telomerase Reverse Transcriptase (674-683) | Details |
| TDSP5 | Details |
| TAMRA-β-Amyloid (1-42), human | 1802087-80-4 | Details |
| SYT-SSX1 or -SSX2 fusion protein (402-410 (SYT)) | Details |
| Talin (777-785) | Details |
| Telomerase reverse transcriptase (766-780) | Details |
| TAG-2 (42-50) | Details |
| Serine protease hepsin (191-199) | Details |
| Small nuclear ribonucleoprotein Sm D1 (11-19) | Details |
| SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | Details |
| Secernin-1 (196-204) | Details |
| Structure-specific endonuclease subunit SLX4 (603-615) | Details |
| Survivin (18-27) | Details |
| Siyry | C50H71N11O13 | 178561-37-0 | Details |
| Serine/threonine-protein kinase mTOR (89-98) | Details |
| SSA protein SS-56 (55-64) | Details |
| Regulator of G-protein signaling 5 (5-13) | Details |
| Rho-related GTP-binding protein RhoC (176-185) | Details |
| Receptor tyrosine-protein kinase erbB-2 (952-961) | Details |
| Regulator of G-protein signaling 5 (74-83) | Details |
| Rho guanine nucleotide exchange factor 17 (425-438) | Details |
| Receptor tyrosine-protein kinase erbB-2 (754-762) | Details |
| Telomerase reverse transcriptase (865-873) | Details |
| Serine/threonine-protein kinase B-raf (586-614) | Details |
| Receptor tyrosine-protein kinase erbB-2 (369-377) | Details |
| Receptor tyrosine-protein kinase erbB-2 (654-662) | Details |
| Receptor tyrosine-protein kinase erbB-2 (1023-1032) | Details |
| Receptor tyrosine-protein kinase erbB-2 (63-71) | Details |
| Receptor tyrosine-protein kinase erbB-2 (391-399) | Details |
| Receptor tyrosine-protein kinase erbB-2 (466-474) | Details |
| Receptor tyrosine-protein kinase erbB-2 (435-443) | Details |
| Receptor tyrosine-protein kinase erbB-2 (48-56) | Details |
| Receptor tyrosine-protein kinase erbB-2 (402-410) | Details |
| Receptor tyrosine-protein kinase erbB-2 (5-13) | Details |
| Receptor tyrosine-protein kinase erbB-2 (665-673) | Details |
| Transcription factor SOX-10 (332-340) | Details |
| Transmembrane glycoprotein NMB (179-188) | Details |
| Trophoblast glycoprotein (17-25) | Details |
| Trafficking protein particle complex subunit 1 (126-134) | Details |
| Transcription factor SOX-10 (331-340) | Details |
| Triosephosphate isomerase 1 (23-37) | Details |
| Receptor tyrosine-protein kinase erbB-2 (650-658) | Details |
| Serine protease hepsin (268-276) | Details |
| Sodium-coupled monocarboxylate transporter 2 (343-356) | Details |
| Surface IgG (sA20-Ig) of A20 (106-114) | Details |
| Serine protease hepsin (229-237) | Details |
| St-Ht31 P | C127H209N29O39 | 252869-81-1 | Details |
| Sperm surface protein Sp17 (103-111) | Details |
| Sarcoma antigen 1 (715-723) | Details |
| Small subunit processome component 20 homolog (626-634) | Details |
| Trafficking protein particle complex subunit 1 (30-38) | Details |
| Trafficking protein particle complex subunit 1 (123-133) | Details |
| Transcriptional repressor CTCF (102-110) | Details |
| Survivin-3A (96-104) | Details |
| Ribosome-binding protein 1 (879-887) | Details |
| (S)-2-hydroxy-3-(2-methylphenyl)-propionic acid | C10H12O3 | 458528-68-2 | Details |
| RPL8 protein (31-41) | Details |
| (S)-2-hydroxy-3-(3-methylphenyl)-propionic acid | C10H12O3 | 458528-71-7 | Details |
| TPQFGYSQLPFYCNFG | Details |
| TPI HLA-DR1 | Details |
| Topoisomerase II-alpha-b (828-836) | Details |
| Tousled-like kinase 1 | Details |
| TPA: ovochymase precursor (314-332) | Details |
| Tos-Gly-Pro-Arg-ANBA-IPA acetate | C32H45N9O10S | 2070009-46-8 | Details |
| TFFYGGSRGKRNNFKTEEYC | C107H154N30O32S | 906480-09-9 | Details |
| TGF-beta receptor type-2 (131-139) | Details |
| Tos-Gly-Pro-Arg-ANBA-IPA | C30H41N9O8S | 99700-50-2 | Details |
| Thymus factor X | 78310-77-7 | Details |
| Threonine synthase-like 1 (S. cerevisiae) (295-305) | Details |
| Tyrosinase (8-17) | Details |
| Tyrosinase (388-397) | Details |
| Type IV collagen alpha 4 chain (170-177) | Details |
| Tyrosinase (450-462) | Details |
| UBX domain-containing protein 11 (447-460) | Details |
| Tyrosinase (312-320) | Details |
| Tyrosinase (146-156) | C56H83N11O19 | Details |
| T-Select H-2Ld P815 (66-74) | Details |
| Tyrosinase precursor (1-9) | Details |
| Tyrosinase (386-406) | Details |
| Tyrosinase (208-216) | Details |
| Tyrosinase (240-251) | Details |
| Tyrosinase (309-320) | Details |
| Tyrosinase-related protein-2 (180-188) | Details |
| Tumour rejection Antigen P815 (35-43) | Details |
| Tyrosinase (56-70) | Details |
| Tyrosinase (90-98) | Details |
| Truncated plakophilin-2 (581-590) | Details |
| Product Total： Product Page： | ||||
| 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 | ||||