Identification | Back Directory | [Name]
LUNASIN | [CAS]
496823-34-8 | [Synonyms]
LUNASIN SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD Ser-Lys-Trp-Gln-His-Gln-Gln-Asp-Ser-Cys-Arg-Lys-Gln-Leu-Gln-Gly-Val-Asn-Leu-Thr-Pro-Cys-Glu-Lys-His-Ile-Met-Glu-Lys-Ile-Gln-Gly-Arg-Gly-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp |
Chemical Properties | Back Directory | [form ]
Solid | [color ]
White to off-white | [Sequence]
Ser-Lys-Trp-Gln-His-Gln-Gln-Asp-Ser-Cys-Arg-Lys-Gln-Leu-Gln-Gly-Val-Asn-Leu-Thr-Pro-Cys-Glu-Lys-His-Ile-Met-Glu-Lys-Ile-Gln-Gly-Arg-Gly-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp |
Hazard Information | Back Directory | [Uses]
Lunasin is a bioactive peptide with antioxidant, anti-inflammatory, anticancer and anti-aging properties. Lunasin can be isolated from soybean. Lunasin also has an epigenetic mechanism of action associated with histone acetylation. Lunasin can be internalized into cells and inhibit Oncosphere formation in cancer cells[1]. | [References]
[1] Alves de Souza SM, et al. Lunasin as a Promising Plant-Derived Peptide for Cancer Therapy. Int J Mol Sci. 2022 Aug 23;23(17):9548. DOI:10.3390/ijms23179548 |
|
|